Structure of PDB 8es7 Chain G |
>8es7G (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKW NLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAE IVSIFVLAVGVYFIAG |
|
PDB | 8es7 Structural analysis of cancer-relevant TCR-CD3 and peptide-MHC complexes by cryoEM |
Chain | G |
Resolution | 3.04 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
Y01 |
G |
T114 F120 A121 |
T92 F98 A99 |
|
|
|
|