Structure of PDB 8el5 Chain G

Receptor sequence

>8el5G (length=64) Species: 464988 (Hemiselmis andersenii)

AMKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIGFNAAEA
ASVTKNYGIKRFGA

3D structure

• PDB: 8el5 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii
• Chain: G
• Resolution: 1.67 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	G	F45 A47	F45 A47
BS02	PEB	G	F14 E16 C20 A22 T25 Q26 K27 A28 G33 F34 C35 K37	F14 E16 C20 A22 T25 Q26 K27 A28 G33 F34 C35 K37
BS03	AX9	G	Y57 G58 F62 A64	Y57 G58 F62 A64
BS04	PEB	G	M2 K4 S6	M2 K4 S6
BS05	PEB	G	V13 F14 R17 F34	V13 F14 R17 F34
BS06	PEB	G	F45 A47	F45 A47
BS07	PEB	G	F14 E16 C20 A22 T25 Q26 K27 A28 G33 F34 C35 K37	F14 E16 C20 A22 T25 Q26 K27 A28 G33 F34 C35 K37

Gene Ontology

Cellular Component

• GO:0030089 phycobilisome

External links

• PDB: RCSB:8el5, PDBe:8el5, PDBj:8el5
• PDBsum: 8el5
• PubMed: 37957226
• UniProt: U5TBU5|PHEA1_HEMAN Phycoerythrin alpha-1 subunit