Structure of PDB 8d8l Chain G

Receptor sequence
>8d8lG (length=146) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PTAEQLAQWEALKSVPIPPRKNATLDHITNMIMRHGKKEKAQTILSRALY
LVYCQTRQDPIQALEKSLDELAPLMMTKTVIPVPLNKRQRNRIAWNWIVQ
SANQRVSSDFAVRLGEELTAIAKGTSSAFEKRDQIHKTAIAHRAYI
3D structure
PDB8d8l Principles of mitoribosomal small subunit assembly in eukaryotes.
ChainG
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G H116 N119 M122 R123 H124 G125 K126 K127 E128 K129 R186 Q187 R190 N201 S206 D207 F208 R211 H27 N30 M33 R34 H35 G36 K37 K38 E39 K40 R88 Q89 R92 N103 S108 D109 F110 R113
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d8l, PDBe:8d8l, PDBj:8d8l
PDBsum8d8l
PubMed36482135
UniProtP47150|RT07_YEAST Small ribosomal subunit protein uS7m (Gene Name=RSM7)

[Back to BioLiP]