Structure of PDB 8cdr Chain G

Receptor sequence
>8cdrG (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDGT
VVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFY
3D structure
PDB8cdr mRNA reading frame maintenance during eukaryotic ribosome translocation
ChainG
Resolution2.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K42 E44 G45 K70 F71 S72 G73 K74 Y75 K77 Y78 K81 K82 K85 K86 R90 R94 V96 S97 N101 Y103 K31 E33 G34 K59 F60 S61 G62 K63 Y64 K66 Y67 K70 K71 K74 K75 R79 R83 V85 S86 N90 Y92
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cdr, PDBe:8cdr, PDBj:8cdr
PDBsum8cdr
PubMed38030725
UniProtP05749|RL22A_YEAST Large ribosomal subunit protein eL22A (Gene Name=RPL22A)

[Back to BioLiP]