Structure of PDB 8c3a Chain G

Receptor sequence

>8c3aG (length=259) Species: 5476 (Candida albicans) [Search protein sequence]

ARGPKKHLKRLAAPSHWMLDKLSGTYAPRPSAGPHKLRESLPLVVFLRNR
LKYALNGREVKAIMMQQHVQVDGKVRTDTTYPAGFMDVITLEATNEHFRL
VYDVKGKFAVHRISAEEAAYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PLIRANDTVKIDLATGKIDDFIKFDTGRLVMVTGGRNLGRVGVIVHREKH
EGGFDLVHIKDALENTFVTRLSNVFVIGTEAGKPWVSLPKGKGIKLSISE
ERDRRRAQQ

3D structure

PDB

8c3a New crystal system to promote screening for new eukaryotic inhibitors

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	A2 R3 P5 K6 K7 H8 K10 R11 L12 S16 M19 D21 K22 S24 T26 Y27 P29 R30 A33 G34 K37 L38 R49 N57 G58 M66 R77 K106 K108 K128 L131 G132 K133 K134 G135 Y138 V140 T146 R148 G186 R187 E199 H201 E202 G203 V219 I249 R256	A1 R2 P4 K5 K6 H7 K9 R10 L11 S15 M18 D20 K21 S23 T25 Y26 P28 R29 A32 G33 K36 L37 R48 N56 G57 M65 R76 K105 K107 K127 L130 G131 K132 K133 G134 Y137 V139 T145 R147 G185 R186 E198 H200 E201 G202 V218 I248 R255
BS02	MG	G	G34 P35	G33 P34

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum	8c3a
PubMed
UniProt	A0A1D8PCI6\|RS4_CANAL Small ribosomal subunit protein eS4 (Gene Name=RPS42)

[Back to BioLiP]