Structure of PDB 8brd Chain G |
>8brdG (length=51) Species: 663 (Vibrio alginolyticus) [Search protein sequence] |
PPPGLPLWMGTFADLMSLLMCFFVLLLSFSEMDVLKFKQIAGSMKFAFGV Q |
|
PDB | 8brd Mechanisms of ion selectivity and rotor coupling in the bacterial flagellar sodium-driven stator unit |
Chain | G |
Resolution | 2.48 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NA |
G |
G20 T21 D24 |
G10 T11 D14 |
|
|
|