Structure of PDB 8azw Chain G

Receptor sequence

>8azwG (length=186) Species: 4097 (Nicotiana tabacum)

GIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKR
LFMSKINKPPLSLSRLISYAKGKEDKVVVIVGTITDDVRAYEVPALKVCA
LRFTKTARARIEKAGGECLTFDQLALRAPLGQNTLLLRGPKNAREAVKHF
GPAPGVPHSHTKPFVRSKGRKFERARGRRNSRGYKA

3D structure

• PDB: 8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
• Chain: G
• Resolution: 2.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	G2 I3 L5 G8 G9 K10 S11 K12 T14 R16 K20 S21 K27 K31 R38 R39 K43 F44 K50 M54 S55 K56 I57 N58 S63 S65 R66 Y70 K74 T86 D87 D88 V89 R90 R103 T105 K106 T107 G132 Q133 N134 L138 R139 G140 K142 N143 A144 R145 E146 A147 F151 G152 V157 P158 H159 H161 K163 P164 F165 R167 S168 K169 R171 K172 F173 R175 R177 R179 R180 N181 S182 R183 G184 Y185 K186	G1 I2 L4 G7 G8 K9 S10 K11 T13 R15 K19 S20 K26 K30 R37 R38 K42 F43 K49 M53 S54 K55 I56 N57 S62 S64 R65 Y69 K73 T85 D86 D87 V88 R89 R102 T104 K105 T106 G131 Q132 N133 L137 R138 G139 K141 N142 A143 R144 E145 A146 F150 G151 V156 P157 H158 H160 K162 P163 F164 R166 S167 K168 R170 K171 F172 R174 R176 R178 R179 N180 S181 R182 G183 Y184 K185

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8azw, PDBe:8azw, PDBj:8azw
• PDBsum: 8azw
• PubMed: 37156858
• UniProt: A0A1S4DF55