Structure of PDB 8ari Chain G

Receptor sequence
>8ariG (length=331) Species: 9606 (Homo sapiens) [Search protein sequence]
RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMY
HTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVE
ETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGET
LGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDL
LFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALA
QALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIE
MREEAAREIRRAITGRIPDSLKNCVNKDHLT
3D structure
PDB8ari Cryo-EM structure of human CtBP1/RAI2(303-362) delta(331-341) filament
ChainG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.1.1.-
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide G A52 F53 C54 H63 A26 F27 C28 H37
BS02 NAD G S100 R184 V185 D204 Y206 C237 T264 R266 W318 S74 R158 V159 D178 Y180 C211 T238 R240 W292
Gene Ontology
Molecular Function
GO:0001221 transcription coregulator binding
GO:0001222 transcription corepressor binding
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0051287 NAD binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006468 protein phosphorylation
GO:0008285 negative regulation of cell population proliferation
GO:0019079 viral genome replication
GO:0030154 cell differentiation
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0048488 synaptic vesicle endocytosis
GO:0050872 white fat cell differentiation
GO:0051726 regulation of cell cycle
GO:0097091 synaptic vesicle clustering
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0017053 transcription repressor complex
GO:0098831 presynaptic active zone cytoplasmic component
GO:0098978 glutamatergic synapse
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ari, PDBe:8ari, PDBj:8ari
PDBsum8ari
PubMed
UniProtQ13363|CTBP1_HUMAN C-terminal-binding protein 1 (Gene Name=CTBP1)

[Back to BioLiP]