Structure of PDB 7zyv Chain G

Receptor sequence
>7zyvG (length=34) Species: 3562 (Spinacia oleracea) [Search protein sequence]
MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQ
3D structure
PDB7zyv High-resolution cryo-EM structures of plant cytochrome b 6 f at work.
ChainG
Resolution2.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide G L27 R31 L27 R31
Gene Ontology
Molecular Function
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0015979 photosynthesis
GO:0017004 cytochrome complex assembly
Cellular Component
GO:0009507 chloroplast
GO:0009512 cytochrome b6f complex
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zyv, PDBe:7zyv, PDBj:7zyv
PDBsum7zyv
PubMed36638176
UniProtP69461|PETG_SPIOL Cytochrome b6-f complex subunit 5 (Gene Name=petG)

[Back to BioLiP]