Structure of PDB 7zqd Chain G

Receptor sequence
>7zqdG (length=95) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQ
KNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS
3D structure
PDB7zqd Algal photosystem I dimer and high-resolution model of PSI-plastocyanin complex.
ChainG
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G F53 Y56 Q57 F22 Y25 Q26
BS02 CLA G I38 S39 T42 H108 F112 I7 S8 T11 H77 F81
BS03 CLA G R50 F51 T89 N90 D91 P92 F95 I97 R19 F20 T58 N59 D60 P61 F64 I66
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zqd, PDBe:7zqd, PDBj:7zqd
PDBsum7zqd
PubMed36229605
UniProtP14224|PSAG_CHLRE Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]