Structure of PDB 7yqk Chain G

Receptor sequence
>7yqkG (length=111) Species: 32630 (synthetic construct) [Search protein sequence]
ARAKACTRSSRAGLQFPVGRVHRLLRKGHYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKT
3D structure
PDB7yqk Chemical Synthesis of Post-Translationally Modified H2AX Reveals Redundancy in Interplay between Histone Phosphorylation, Ubiquitination, and Methylation on the Binding of 53BP1 with Nucleosomes.
ChainG
Resolution3.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R11 R29 R42 V43 G44 A45 K75 T76 R77 R2 R20 R33 V34 G35 A36 K66 T67 R68
BS02 dna G A10 A14 C15 R17 R20 R29 R32 R77 A1 A5 C6 R8 R11 R20 R23 R68
BS03 peptide G Y57 E61 Y48 E52
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7yqk, PDBe:7yqk, PDBj:7yqk
PDBsum7yqk
PubMed36166692
UniProtP16104|H2AX_HUMAN Histone H2AX (Gene Name=H2AX)

[Back to BioLiP]