Structure of PDB 7ye1 Chain G |
>7ye1G (length=103) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] |
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGLSPGSA TVLTLGAHMCKWPIGDPSSEGFTFCGRRSSEGPYCVEHARVAYQPQQTKK KSG |
|
PDB | 7ye1 Cryo-EM structures of Caulobacter crescentus transcription activation complex with an essential cell cycle regulator GcrA |
Chain | G |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
G |
W3 R42 |
W3 R42 |
|
BS02 |
ZN |
G |
C133 H146 |
C75 H88 |
|
|
|
|