Structure of PDB 7xuz Chain G |
>7xuzG (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] |
KKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNK LFQYASMDKVLLKYTEYNEPHESRTNSDIVEA |
|
PDB | 7xuz Structural insights into transcription regulation by the higher-order HDAC4-MEF2-DNA complex |
Chain | G |
Resolution | 3.591 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
G |
K4 R24 K30 K31 |
K1 R21 K27 K28 |
|
|
|
|