Structure of PDB 7vzg Chain G

Receptor sequence
>7vzgG (length=38) Species: 458033 (Chloracidobacterium thermophilum) [Search protein sequence]
DISKVAWAWFGVLLAICLIGAFGNYVPKLFVKMLMFLN
3D structure
PDB7vzg Structure of the Acidobacteria homodimeric reaction center bound with cytochrome c.
ChainG
Resolution2.61 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide G Y32 K35 V38 Y25 K28 V31
BS02 85N G I26 G30 M40 F43 I19 G23 M33 F36
BS03 85N G S10 A13 S3 A6
External links