Structure of PDB 7uoo Chain G

Receptor sequence

>7uooG (length=224) Species: 1247190 (Saccharomyces cerevisiae BY4741)

NPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPP
TIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVSPKPYAV
KYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIVKG
KARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKH
WGGGILGNKAQAKMDKRAKNSDSA

3D structure

• PDB: 7uoo rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
• Chain: G
• Resolution: 2.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	T27 H28 T30 K32 N33 F34 G35 I36 G37 Q38 Q41 P42 K43 R44 L46 R48 Y49 K51 P53 E54 Y55 K63 L65 R68 E100 K105 R108 S126 K128 P129 K133 Y134 G135 L136 N137 H138 A141 L142 K147 D158 L162 A184 K193 T194 G239 N240 K241 A242 K245	T4 H5 T7 K9 N10 F11 G12 I13 G14 Q15 Q18 P19 K20 R21 L23 R25 Y26 K28 P30 E31 Y32 K40 L42 R45 E77 K82 R85 S94 K96 P97 K101 Y102 G103 L104 N105 H106 A109 L110 K115 D126 L130 A152 K161 T162 G207 N208 K209 A210 K213
BS02	rna	G	Y55 V56 Q59 R60 K63 K181 R185	Y32 V33 Q36 R37 K40 K149 R153
BS03	rna	G	N85 E89 A212 K213 S216	N62 E66 A180 K181 S184

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uoo, PDBe:7uoo, PDBj:7uoo
• PDBsum: 7uoo
• PubMed: 36864048
• UniProt: P17076|RL8A_YEAST Large ribosomal subunit protein eL8A (Gene Name=RPL8A)