Structure of PDB 7u0g Chain G

Receptor sequence
>7u0gG (length=109) Species: 9606 (Homo sapiens) [Search protein sequence]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN
IQAVLLPKK
3D structure
PDB7u0g Structural mechanism of LIN28B nucleosome targeting by OCT4.
ChainG
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R12 R30 R43 V44 G45 K76 T77 R78 R1 R19 R32 V33 G34 K65 T66 R67
BS02 dna G R12 A15 R18 R21 R33 R43 R78 R1 A4 R7 R10 R22 R32 R67
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7u0g, PDBe:7u0g, PDBj:7u0g
PDBsum7u0g
PubMed37327775
UniProtQ16777|H2A2C_HUMAN Histone H2A type 2-C (Gene Name=H2AC20)

[Back to BioLiP]