Structure of PDB 7sut Chain G

Receptor sequence
>7sutG (length=63) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]
LRAPIITVFDARGCREHKNREYKGPKTGTQDDEMCVKVQYEKIAACEDTA
FIVLKECLSEMKS
3D structure
PDB7sut MX2: a high-flux undulator microfocus beamline serving both the chemical and macromolecular crystallography communities at the Australian Synchrotron.
ChainG
Resolution1.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 X2I G F14 C19 E21 H22 N24 E26 Y27 E38 M39 C40 K42 F9 C14 E16 H17 N19 E21 Y22 E33 M34 C35 K37
BS02 PEB G V13 R17 Q35 M39 V8 R12 Q30 M34
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Feb 18 13:17:07 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7sut', asym_id = 'G', title = 'MX2: a high-flux undulator microfocus beamline s...raphy communities at the Australian Synchrotron. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7sut', asym_id='G', title='MX2: a high-flux undulator microfocus beamline s...raphy communities at the Australian Synchrotron. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0030089', uniprot = '', pdbid = '7sut', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0030089', uniprot='', pdbid='7sut', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>