Structure of PDB 7ssa Chain G

Receptor sequence

>7ssaG (length=104) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQN
LLPK

3D structure

PDB

7ssa Basic helix-loop-helix pioneer factors interact with the histone octamer to invade nucleosomes and generate nucleosome-depleted regions.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	R30 R43 G45 S46 T77	R15 R28 G30 S31 T62
BS02	dna	G	R18 R33 R43	R3 R18 R28

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex

External links

PDB	RCSB:7ssa, PDBe:7ssa, PDBj:7ssa
PDBsum	7ssa
PubMed	36996811
UniProt	P04911\|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)