Structure of PDB 7r3k Chain G

Receptor sequence
>7r3kG (length=67) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
LDPQIVISGSTAAFLAIGRFVFLGYQRREANFATNDPAGFNIIDVAGWGA
LGHAVGFAVLAINSLQG
3D structure
PDB7r3k Structure of Photosystem I Supercomplex Isolated from a Chlamydomonas reinhardtii Cytochrome b6f Temperature-Sensitive Mutant.
ChainG
Resolution2.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G A113 A116 A58 A61
BS02 CLA G F45 F53 Y56 Q57 E60 A61 W103 L106 F14 F22 Y25 Q26 E29 A30 W48 L51
BS03 CLA G Q35 I38 S39 T42 A43 H108 F112 Q4 I7 S8 T11 A12 H53 F57
BS04 CLA G L46 R50 F51 T89 N90 D91 P92 F95 N96 I97 V100 L15 R19 F20 T34 N35 D36 P37 F40 N41 I42 V45
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r3k, PDBe:7r3k, PDBj:7r3k
PDBsum7r3k
PubMed36979472
UniProtP14224|PSAG_CHLRE Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]