Structure of PDB 7qwq Chain G

Receptor sequence

>7qwqG (length=241) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

KVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLK
VPPAINQFTQVLDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGK
GDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCR
KMGVPYCILKGKARLCRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTN
YNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG

3D structure

PDB

7qwq Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.

Chain

Resolution

2.83 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	E33 K34 K37 F39 G40 I41 G42 I45 Q46 P47 R49 L51 R53 F54 V55 K56 P58 R59 Y60 I69 L70 K72 R73 K75 E105 K107 Q108 K110 R113 R132 P133 A138 G139 V140 N141 T142 V161 P163 L166 K187 A188 R196 K197 T198 T200 P244 K245	E8 K9 K12 F14 G15 I16 G17 I20 Q21 P22 R24 L26 R28 F29 V30 K31 P33 R34 Y35 I44 L45 K47 R48 K50 E80 K82 Q83 K85 R88 R107 P108 A113 G114 V115 N116 T117 V136 P138 L141 K162 A163 R171 K172 T173 T175 P219 K220
BS02	rna	G	T52 Y60 I61 Q64 R65 R89 H159 K185 R189	T27 Y35 I36 Q39 R40 R64 H134 K160 R164

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qwq, PDBe:7qwq, PDBj:7qwq
PDBsum	7qwq
PubMed	35201867
UniProt	G1STW0\|RL7A_RABIT Large ribosomal subunit protein eL8 (Gene Name=RPL7A)

[Back to BioLiP]