Structure of PDB 7qu4 Chain G

Receptor sequence

>7qu4G (length=143) Species: 9606 (Homo sapiens)

FTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSAS
AIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPEN
FKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRY

3D structure

• PDB: 7qu4 Structural and oxidative investigation of a recombinant high-yielding fetal hemoglobin mutant.
• Chain: G
• Resolution: 1.66 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	G	T38 F41 F42 H63 K66 V67 H92 L96 N102 F103 L106 L141	T36 F39 F40 H61 K64 V65 H90 L94 N100 F101 L104 L139

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015670 carbon dioxide transport
• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005829 cytosol
• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:7qu4, PDBe:7qu4, PDBj:7qu4
• PDBsum: 7qu4
• PubMed: 37006610
• UniProt: P69892|HBG2_HUMAN Hemoglobin subunit gamma-2 (Gene Name=HBG2)