Structure of PDB 7qiy Chain G

Receptor sequence

>7qiyG (length=126) Species: 4081 (Solanum lycopersicum) [Search protein sequence]

KKFSYRGVDLDSLLDMSTDELVKLYPARPRRRFQRGLKRKPMALIKKLRK
AKREAPQGEKPEVVRTHLRNMIIVPEMIGSVIGIYNGKTFNQIEVKPEMI
SHYLAEFSISYKPVKHGRPGIGATHS

3D structure

PDB

7qiy Cryo-EM structure and rRNA modification sites of a plant ribosome.

Chain

Resolution

2.58 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	R24 P44 A45 R46 R48 R49 R50 R53 K65 R83 T84 H85 R87 N88 Y103 N104 G105 K106 F108 Y121 A123 E124 S128 Y129 K133 H134 G135 R136 P137 G138 G140 A141 S144	R6 P26 A27 R28 R30 R31 R32 R35 K47 R65 T66 H67 R69 N70 Y85 N86 G87 K88 F90 Y103 A105 E106 S110 Y111 K115 H116 G117 R118 P119 G120 G122 A123 S126
BS02	rna	G	T142 H143	T124 H125

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links