Structure of PDB 7qgu Chain G

Receptor sequence
>7qguG (length=175) Species: 1423 (Bacillus subtilis) [Search protein sequence]
SRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVL
TVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSG
NKLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRA
VRSPEPYKGKGIRYEGEVVRRKEGK
3D structure
PDB7qgu Ribosome collisions induce mRNA cleavage and ribosome rescue in bacteria.
ChainG
Resolution4.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G S2 V4 K60 R63 A64 L65 G67 T68 S71 N75 Y110 S111 H112 E140 G143 Y158 K159 K176 S1 V3 K59 R62 A63 L64 G66 T67 S70 N74 Y109 S110 H111 E139 G142 Y157 K158 K175
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 07:29:43 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7qgu', asym_id = 'G', title = 'Ribosome collisions induce mRNA cleavage and ribosome rescue in bacteria.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7qgu', asym_id='G', title='Ribosome collisions induce mRNA cleavage and ribosome rescue in bacteria.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '7qgu', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='7qgu', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>