Structure of PDB 7q5n Chain G |
>7q5nG (length=103) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] |
EEIPITVDFSGGLEMLFDNQRRHSISLPAKDTEGKPVTIAFLIDYISKKL MKDPRTDLFVLDNHIRPGILVLINDADWELEGEEAYEIQPNDNILFVSTL HGG |
|
PDB | 7q5n E2/E3-independent ubiquitin-like protein conjugation by Urm1 is directly coupled to cysteine persulfidation. |
Chain | G |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
G |
H72 E92 |
H64 E84 |
|
|
|
|