Structure of PDB 7po1 Chain G

Receptor sequence

>7po1G (length=325) Species: 9606 (Homo sapiens)

VIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDI
DRAIAYLFPSGLFEKRARPVMKHPEQIFPRQRAIQWGEDGRPFHYLFYTG
KQSYYSLMHDVYGMLLNLEKHQVIGSRWLIKEELEEMLVEKLSDLDYMQF
IRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQLIEPVQYDEQGMAFSK
SEGKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVD
RLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLT
TDPRVRERKKPGQEGARRKFTWKKR

3D structure

• PDB: 7po1 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
• Chain: G
• Resolution: 2.92 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K59 F117 E118 R120 K212 L216 D217 Q220 R276 K277 T278 I306 G336 R337 S338 A339 R375 V376 R377 E378 R379 K380 K381 P382 G383 R388 R389 K390 T392 W393 K394 K395	K5 F63 E64 R66 K141 L145 D146 Q149 R205 K206 T207 I235 G265 R266 S267 A268 R304 V305 R306 E307 R308 K309 K310 P311 G312 R317 R318 K319 T321 W322 K323 K324

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7po1, PDBe:7po1, PDBj:7po1
• PDBsum: 7po1
• PubMed: 35676484
• UniProt: P82933|RT09_HUMAN Small ribosomal subunit protein uS9m (Gene Name=MRPS9)