Structure of PDB 7pir Chain G

Receptor sequence

>7pirG (length=141) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]

ITTTKPIKAHFDPVADLLTKINNARKAKLMTVTTIASKLKIAILEILVKE
GYLANFQVLENKSKTKRIVTFNLKYTQRRIPSINGVKQISKPGLRIYRPF
EKLPLVLNGLGIAIISTSDGVMTDKVARLKKIGGEILAYVW

3D structure

PDB

7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.

Chain

Resolution

12.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	I8 K9 A10 H11 F12 A16 T20 K21 N23 N24 R26 K27 K29 I36 A37 K39 K65 T66 K67 R68 K88 Q89 K92 P93 G94 R96 Y98 P100 F101 S117 T118 S119 D120 G121 K132 I133 G134 E136	I7 K8 A9 H10 F11 A15 T19 K20 N22 N23 R25 K26 K28 I35 A36 K38 K64 T65 K66 R67 K87 Q88 K91 P92 G93 R95 Y97 P99 F100 S116 T117 S118 D119 G120 K131 I132 G133 E135

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum	7pir
PubMed	36171285
UniProt	Q50304\|RS8_MYCPN Small ribosomal subunit protein uS8 (Gene Name=rpsH)