Structure of PDB 7paq Chain G

Receptor sequence
>7paqG (length=141) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
ITTTKPIKAHFDPVADLLTKINNARKAKLMTVTTIASKLKIAILEILVKE
GYLANFQVLENKSKTKRIVTFNLKYTQRRIPSINGVKQISKPGLRIYRPF
EKLPLVLNGLGIAIISTSDGVMTDKVARLKKIGGEILAYVW
3D structure
PDB7paq Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainG
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K9 A10 H11 F12 D13 K21 N23 N24 K27 A28 I36 K39 L40 T66 K67 K92 P93 G94 R96 Y98 P100 F101 S117 T118 S119 G121 K132 I133 G134 K8 A9 H10 F11 D12 K20 N22 N23 K26 A27 I35 K38 L39 T65 K66 K91 P92 G93 R95 Y97 P99 F100 S116 T117 S118 G120 K131 I132 G133
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7paq, PDBe:7paq, PDBj:7paq
PDBsum7paq
PubMed36171285
UniProtQ50304|RS8_MYCPN Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]