Structure of PDB 7pak Chain G

Receptor sequence
>7pakG (length=141) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
ITTTKPIKAHFDPVADLLTKINNARKAKLMTVTTIASKLKIAILEILVKE
GYLANFQVLENKSKTKRIVTFNLKYTQRRIPSINGVKQISKPGLRIYRPF
EKLPLVLNGLGIAIISTSDGVMTDKVARLKKIGGEILAYVW
3D structure
PDB7pak Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainG
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K9 H11 F12 N23 N24 K27 I36 K39 K67 K92 P93 Y98 P100 S117 T118 S119 G121 G134 K8 H10 F11 N22 N23 K26 I35 K38 K66 K91 P92 Y97 P99 S116 T117 S118 G120 G133
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pak, PDBe:7pak, PDBj:7pak
PDBsum7pak
PubMed36171285
UniProtQ50304|RS8_MYCPN Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]