Structure of PDB 7p7s Chain G

Receptor sequence

>7p7sG (length=274) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

AIKKYKPTTNGRRNMTSSDFAEITTSTPEKSLLQPLKNNAGRNNNGRITV
RHQGGGHKRQYRVIDFKRNKDNVAAVVKTIEYDPNRSANIALVHYEDGVK
AYILAPKGLEVGMRLVSGPEADIKVGNALPLENIPVGTVIHNIEMKPGKG
GQLIRSAGTSAQVLGKEGKYVLIRLNSGEVRMILATCRATIGSVGNEQHE
LINIGKAGRSRWMRKRPTVRGSVMNPNDHPHGGGEGKTPIGRKAPVSPWG
QPAIGYKTRNKKAKSDKLIVRRRT

3D structure

PDB

7p7s Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K4 K7 P8 T10 N11 G12 R13 R14 N15 K31 P36 K38 N39 N40 A41 G42 R43 N44 N45 N46 G47 R48 I49 T50 V51 R52 H53 Q54 G56 H58 K59 R60 Q61 Y62 R63 K79 Y83 P85 R87 H95 E97 D98 G99 K101 R115 M146 K147 K150 Q153 L154 I155 R156 S157 A158 G159 T160 K170 Y171 L176 N177 S178 E180 R182 E198 H200 E201 N204 I205 G206 K207 A208 G209 R210 S211 R212 W213 R217 P218 T219 V220 R221 G222 S223 V224 M225 N226 P227 N228 D229 H230 H232 G234 G235 E236 G237 K238 T239 P240 I241 G242 R243 K244 P246 V247 S248 P249 W250 Q252 A254 I255 G256 Y257 K258 T259 R260 K263 K265 S266 T275	K3 K6 P7 T9 N10 G11 R12 R13 N14 K30 P35 K37 N38 N39 A40 G41 R42 N43 N44 N45 G46 R47 I48 T49 V50 R51 H52 Q53 G55 H57 K58 R59 Q60 Y61 R62 K78 Y82 P84 R86 H94 E96 D97 G98 K100 R114 M145 K146 K149 Q152 L153 I154 R155 S156 A157 G158 T159 K169 Y170 L175 N176 S177 E179 R181 E197 H199 E200 N203 I204 G205 K206 A207 G208 R209 S210 R211 W212 R216 P217 T218 V219 R220 G221 S222 V223 M224 N225 P226 N227 D228 H229 H231 G233 G234 E235 G236 K237 T238 P239 I240 G241 R242 K243 P245 V246 S247 P248 W249 Q251 A253 I254 G255 Y256 K257 T258 R259 K262 K264 S265 T274

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7p7s, PDBe:7p7s, PDBj:7p7s
PDBsum	7p7s
PubMed	35387982
UniProt	A0A1B4XKR6

[Back to BioLiP]