Structure of PDB 7p2e Chain G

Receptor sequence

>7p2eG (length=330) Species: 9606 (Homo sapiens)

RHTAFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETF
TQEDIDRAIAYLFPSGLFEKRARPVMKHPEQIFPRQRAIQWGEDGRPFHY
LFYTGKQSYYSLMHDVYGMLLNLEKHQVIGSRWLIKEELEEMLVEKLSDL
DYMQFIRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQLIEPVQYDEQG
MAFSKSEGKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFP
FHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQ
AGLLTTDPRVRERKKPGQEGARRKFTWKKR

3D structure

• PDB: 7p2e Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
• Chain: G
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	R50 H51 F117 E118 K212 L216 D217 Q220 R276 K277 T278 I306 G336 S338 A339 R375 V376 R377 E378 R379 K380 K381 P382 G383 R388 R389 K390 T392 W393 K394 K395	R1 H2 F68 E69 K146 L150 D151 Q154 R210 K211 T212 I240 G270 S272 A273 R309 V310 R311 E312 R313 K314 K315 P316 G317 R322 R323 K324 T326 W327 K328 K329

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7p2e, PDBe:7p2e, PDBj:7p2e
• PDBsum: 7p2e
• PubMed: 36480258
• UniProt: P82933|RT09_HUMAN Small ribosomal subunit protein uS9m (Gene Name=MRPS9)