Structure of PDB 7ope Chain G

Receptor sequence

>7opeG (length=205) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

PKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGTHKV
KNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKL
PKKVRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKK
ALIVTADANEAVALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEK
VEEVL

3D structure

PDB

7ope RqcH and RqcP catalyze processive poly-alanine synthesis in a reconstituted ribosome-associated quality control system.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	N29 F34 M39 Q40 R41 R45 Q46 T48 V51 K52 N53 R54 S55 V57 R58 G59 R62 K63 Q67 K68 G69 T70 G71 R72 R74 G76 R79 Q82 W83 R84 G85 V88 V89 F90 R95 K100 L101 P102 K103 K104 V105 R106 K135 T136 K137 L165 R168 N169 G180 N182	N28 F33 M38 Q39 R40 R44 Q45 T47 V50 K51 N52 R53 S54 V56 R57 G58 R61 K62 Q66 K67 G68 T69 G70 R71 R73 G75 R78 Q81 W82 R83 G84 V87 V88 F89 R94 K99 L100 P101 K102 K103 V104 R105 K134 T135 K136 L164 R167 N168 G179 N181

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ope, PDBe:7ope, PDBj:7ope
PDBsum	7ope
PubMed	34255840
UniProt	P42921\|RL4_BACSU Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]