Structure of PDB 7o5b Chain G

Receptor sequence
>7o5bG (length=149) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
KGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYKSFDIIKER
TGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRW
LVNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFA
3D structure
PDB7o5b Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp.
ChainG
Resolution3.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G R79 G81 R76 G78
BS02 rna G K4 P6 V7 K9 I32 D33 G34 K35 K38 R78 R92 R95 R102 R109 K114 K1 P3 V4 K6 I29 D30 G31 K32 K35 R75 R89 R92 R99 R106 K111
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o5b, PDBe:7o5b, PDBj:7o5b
PDBsum7o5b
PubMed35217658
UniProtP21469|RS7_BACSU Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]