Structure of PDB 7nz0 Chain G

Receptor sequence

>7nz0G (length=72) Species: 469008 (Escherichia coli BL21(DE3))

TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFD
TEIPDEEAEKITTVQAAIDYIN

3D structure

• PDB: 7nz0 Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.
• Chain: G
• Resolution: 6.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D35
• Catalytic site (residue number reindexed from 1): D34

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PNS	G	S36 L37 V40	S35 L36 V39

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0000036 acyl carrier activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0031177 phosphopantetheine binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process
• GO:0009410 response to xenobiotic stimulus

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7nz0, PDBe:7nz0, PDBj:7nz0
• PDBsum: 7nz0
• PubMed: 34739874
• UniProt: P0A6A8|ACP_ECOLI Acyl carrier protein (Gene Name=acpP)