Structure of PDB 7nyw Chain G

Receptor sequence
>7nywG (length=72) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence]
TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFD
TEIPDEEAEKITTVQAAIDYIN
3D structure
PDB7nyw Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.
ChainG
Resolution3.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D35
Catalytic site (residue number reindexed from 1) D34
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PNS G S36 L37 V40 S35 L36 V39
Gene Ontology
Molecular Function
GO:0000035 acyl binding
GO:0000036 acyl carrier activity
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0031177 phosphopantetheine binding
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0008610 lipid biosynthetic process
GO:0009245 lipid A biosynthetic process
GO:0009410 response to xenobiotic stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nyw, PDBe:7nyw, PDBj:7nyw
PDBsum7nyw
PubMed34739874
UniProtP0A6A8|ACP_ECOLI Acyl carrier protein (Gene Name=acpP)

[Back to BioLiP]