Structure of PDB 7nwh Chain G

Receptor sequence
>7nwhG (length=233) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
VVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKV
PPAINQFTQVLDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAKRP
PVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCI
LKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEI
RRHWGGNVLGPKSVARIAKLEKAKAKELATKLG
3D structure
PDB7nwh Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.
ChainG
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K87 R88 K90 F92 I94 R102 L104 R106 F107 K109 R115 Q161 R166 R185 A191 G192 V193 N194 T195 V214 R249 K250 T253 P297 R302 K8 R9 K11 F13 I15 R23 L25 R27 F28 K30 R36 Q82 R87 R99 A105 G106 V107 N108 T109 V128 R163 K164 T167 P211 R216
BS02 rna G Q117 R118 Q38 R39
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 18:16:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nwh', asym_id = 'G', title = 'Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nwh', asym_id='G', title='Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0042254,1990904', uniprot = '', pdbid = '7nwh', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042254,1990904', uniprot='', pdbid='7nwh', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>