Structure of PDB 7lj1 Chain G

Receptor sequence
>7lj1G (length=182) Species: 9606 (Homo sapiens) [Search protein sequence]
SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV
CPTEIIAFSDRAEEFKKLNSQVIGASVDSHFVHLAWVNTPKKQGGLGPMN
IPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGR
SVDETLRLVQAFQFTDKHGEVSPAGWKPGSDT
3D structure
PDB7lj1 Specificity of Human Sulfiredoxin for Reductant and Peroxiredoxin Oligomeric State.
ChainG
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.11.1.24: thioredoxin-dependent peroxiredoxin.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP G C52 K93 G95 C51 K92 G94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004601 peroxidase activity
GO:0005515 protein binding
GO:0008379 thioredoxin peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0045296 cadherin binding
GO:0051920 peroxiredoxin activity
GO:0140824 thioredoxin-dependent peroxiredoxin activity
Biological Process
GO:0000302 response to reactive oxygen species
GO:0001501 skeletal system development
GO:0006979 response to oxidative stress
GO:0007249 canonical NF-kappaB signal transduction
GO:0008283 cell population proliferation
GO:0019430 removal of superoxide radicals
GO:0030101 natural killer cell activation
GO:0032872 regulation of stress-activated MAPK cascade
GO:0033554 cellular response to stress
GO:0034101 erythrocyte homeostasis
GO:0042267 natural killer cell mediated cytotoxicity
GO:0042744 hydrogen peroxide catabolic process
GO:0045321 leukocyte activation
GO:0045454 cell redox homeostasis
GO:0048144 fibroblast proliferation
GO:1901222 regulation of non-canonical NF-kappaB signal transduction
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0042470 melanosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lj1, PDBe:7lj1, PDBj:7lj1
PDBsum7lj1
PubMed34208049
UniProtQ06830|PRDX1_HUMAN Peroxiredoxin-1 (Gene Name=PRDX1)

[Back to BioLiP]