Structure of PDB 7kux Chain G

Receptor sequence
>7kuxG (length=91) Species: 3218 (Physcomitrium patens) [Search protein sequence]
ANTALTITLSTGALLFLGRFVFLPFQRDNVSRQGLPVQNGVTHFDAGDSR
AQEVTSFLKTNDPAGFTIVDVLAWGALGHAVGFFILATINN
3D structure
PDB7kux The structure of the Physcomitrium patens photosystem I reveals a unique Lhca2 paralogue replacing Lhca4.
ChainG
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G F142 A145 N149 F84 A87 N91
BS02 CLA G F115 L130 F57 L72
BS03 CLA G F80 F83 N87 Q91 F22 F25 N29 Q33
BS04 CLA G T61 A62 I65 T66 T69 G70 H137 F141 T3 A4 I7 T8 T11 G12 H79 F83
BS05 CLA G L73 R77 F78 T118 N119 D120 F124 I126 L15 R19 F20 T60 N61 D62 F66 I68
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kux, PDBe:7kux, PDBj:7kux
PDBsum7kux
PubMed35190662
UniProtA0A2K1JC42

[Back to BioLiP]