Structure of PDB 7eyi Chain G

Receptor sequence

>7eyiG (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]

HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHM
RKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSD
HLHRHLKKDGC

3D structure

PDB

7eyi Structural basis for human ZBTB7A action at the fetal globin promoter.

Chain

Resolution

2.401 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	G	Q422 N450 Y451 S478 D479 H482	Q43 N71 Y72 S99 D100 H103
BS02	dna	G	I391 Q392 K396 R399 H400 R421 K424 K431 K436 F447 R464 K473 R477 H480 R483	I12 Q13 K17 R20 H21 R42 K45 K52 K57 F68 R85 K94 R98 H101 R104
BS03	dna	G	K486 K487	K107 K108
BS04	ZN	G	C384 C387 H400 H404	C5 C8 H21 H25
BS05	ZN	G	C412 C415 H428 H432	C33 C36 H49 H53
BS06	ZN	G	C440 C443 H456 H460	C61 C64 H77 H81
BS07	ZN	G	C468 C471 H484	C89 C92 H105

External links

PDB	RCSB:7eyi, PDBe:7eyi, PDBj:7eyi
PDBsum	7eyi
PubMed	34592153
UniProt	O95365\|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)