Structure of PDB 7et4 Chain G

Receptor sequence
>7et4G (length=99) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
KLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVRR
FRGRDAVTNFKSQVDGNDAESAFLDAHSKAEIVDMLRKHTYADEFEQSR
3D structure
PDB7et4 TEM1 combinatorially binds to FLOWERING LOCUS T and recruits a Polycomb factor to repress the floral transition in Arabidopsis.
ChainG
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G S69 K73 G74 Y88 H91 R117 S4 K8 G9 Y23 H26 R52
BS02 dna G Q78 R82 R93 W95 T98 Q13 R17 R28 W30 T33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7et4, PDBe:7et4, PDBj:7et4
PDBsum7et4
PubMed34446554
UniProtQ9C6M5|RAVL1_ARATH AP2/ERF and B3 domain-containing transcription repressor TEM1 (Gene Name=TEM1)

[Back to BioLiP]