Structure of PDB 7eg6 Chain G

Receptor sequence
>7eg6G (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
3D structure
PDB7eg6 Structure of the SWI/SNF complex bound to the nucleosome and insights into the functional modularity.
ChainG
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide G E56 E61 E64 L65 D90 E91 E92 E45 E50 E53 L54 D79 E80 E81
BS02 dna G A14 K15 R17 R20 R32 R77 A3 K4 R6 R9 R21 R66
BS03 dna G R29 R42 V43 G44 A45 T76 R77 R18 R31 V32 G33 A34 T65 R66
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7eg6, PDBe:7eg6, PDBj:7eg6
PDBsum7eg6
PubMed33907182
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]