Structure of PDB 7e9f Chain G

Receptor sequence
>7e9fG (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQN
LL
3D structure
PDB7e9f Nucleosome binding relinquishes the association of the BAH domain of Orc1 with Sir1
ChainG
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G S17 R18 G29 R33 R43 S2 R3 G14 R18 R28
BS02 dna G R30 R43 I44 G45 S46 K76 T77 R78 R15 R28 I29 G30 S31 K61 T62 R63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e9f, PDBe:7e9f, PDBj:7e9f
PDBsum7e9f
PubMed
UniProtP04912|H2A2_YEAST Histone H2A.2 (Gene Name=HTA2)

[Back to BioLiP]