Structure of PDB 7dz7 Chain G

Receptor sequence
>7dz7G (length=94) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQ
KNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANL
3D structure
PDB7dz7 Structural basis of LhcbM5-mediated state transitions in green algae.
ChainG
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G A113 A116 A82 A85
BS02 CLA G Y56 Q57 E60 A61 Y25 Q26 E29 A30
BS03 CLA G Q35 I38 S39 H108 Q4 I7 S8 H77
BS04 CLA G R50 F51 N90 D91 P92 F95 N96 I97 V100 R19 F20 N59 D60 P61 F64 N65 I66 V69
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dz7, PDBe:7dz7, PDBj:7dz7
PDBsum7dz7
PubMed34239095
UniProtP14224|PSAG_CHLRE Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]