Structure of PDB 7dkz Chain G

Receptor sequence

>7dkzG (length=95) Species: 3888 (Pisum sativum)

LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTR
AKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDP

3D structure

• PDB: 7dkz Structure of plant photosystem I-light harvesting complex I supercomplex at 2.4 angstrom resolution.
• Chain: G
• Resolution: 2.393 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	G	R51 Y55	R50 Y54
BS02	CLA	G	A88 N92	A87 N91
BS03	CLA	G	F26 Q27 N30 V31 Q34	F25 Q26 N29 V30 Q33
BS04	CLA	G	S5 I8 S9 T12 H80 Y84	S4 I7 S8 T11 H79 Y83
BS05	CLA	G	R20 F21 N62 D63 P64 F67 N68 I69	R19 F20 N61 D62 P63 F66 N67 I68

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 12:56:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7dkz', asym_id = 'G', title = 'Structure of plant photosystem I-light harvesting complex I supercomplex at 2.4 angstrom resolution.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7dkz', asym_id='G', title='Structure of plant photosystem I-light harvesting complex I supercomplex at 2.4 angstrom resolution.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0009535,0015979,0016020', uniprot = '', pdbid = '7dkz', asym_id = 'G'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009535,0015979,0016020', uniprot='', pdbid='7dkz', asym_id='G')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>