Structure of PDB 7dbh Chain G

Receptor sequence
>7dbhG (length=96) Species: 10090 (Mus musculus) [Search protein sequence]
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLP
3D structure
PDB7dbh Unusual nucleosome formation and transcriptome influence by the histone H3mm18 variant.
ChainG
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R29 R42 G44 A45 K75 T76 R16 R29 G31 A32 K62 T63
BS02 dna G K15 T16 R17 R29 R32 R77 K2 T3 R4 R16 R19 R64
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dbh, PDBe:7dbh, PDBj:7dbh
PDBsum7dbh
PubMed34929737
UniProtC0HKE1|H2A1B_MOUSE Histone H2A type 1-B (Gene Name=H2ac4)

[Back to BioLiP]