Structure of PDB 7d94 Chain G

Receptor sequence

>7d94G (length=32) Species: 9823 (Sus scrofa) [Search protein sequence]

DPFYYDYETVRNGGLIFAALAFIVGLIIILSK

3D structure

PDB

7d94 Binding of cardiotonic steroids to Na + ,K + -ATPase in the E2P state.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	G	G29 G30 F33	G13 G14 F17

Gene Ontology

	Molecular Function
GO:0001671	ATPase activator activity
GO:0005515	protein binding
GO:0030674	protein-macromolecule adaptor activity
GO:0099106	ion channel regulator activity

	Biological Process
GO:0006811	monoatomic ion transport
GO:0006883	intracellular sodium ion homeostasis
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient
GO:0030007	intracellular potassium ion homeostasis
GO:0036376	sodium ion export across plasma membrane
GO:0043269	regulation of monoatomic ion transport
GO:0055085	transmembrane transport
GO:1902600	proton transmembrane transport
GO:1903408	positive regulation of P-type sodium:potassium-exchanging transporter activity
GO:1990573	potassium ion import across plasma membrane

	Cellular Component
GO:0005890	sodium:potassium-exchanging ATPase complex
GO:0016020	membrane

External links