Structure of PDB 7coh Chain G |
>7cohG (length=72) Species: 9913 (Bos taurus) [Search protein sequence] |
GARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFS WGDGNHTFFHNPRVNPLPTGYE |
|
PDB | 7coh The 1.3-A Resolution structure of bovine cytochrome c oxidase suggests a dimerization mechanism |
Chain | G |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DMU |
G |
C31 H38 |
C20 H27 |
|
|
|
|