Structure of PDB 7blx Chain G

Receptor sequence
>7blxG (length=74) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSNSTIFATNDPAGFNII
DVAGWGALGHAVGFAVLAINSLQG
3D structure
PDB7blx Dimeric and high-resolution structures of Chlamydomonas Photosystem I from a temperature-sensitive Photosystem II mutant
ChainG
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G A113 A116 L120 A65 A68 L72
BS02 CLA G Y56 Q57 E60 Y25 Q26 E29
BS03 CLA G Q35 I38 S39 A43 H108 F112 Q4 I7 S8 A12 H60 F64
BS04 CLA G R50 F51 N90 D91 P92 V100 R19 F20 N42 D43 P44 V52
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7blx, PDBe:7blx, PDBj:7blx
PDBsum7blx
PubMed
UniProtP14224|PSAG_CHLRE Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]