Structure of PDB 7b9v Chain G

Receptor sequence
>7b9vG (length=138) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SRNVDKANSVLVRFQEQQAESAGGYKDYSRYQRPRNVSKVKSIKEANEWK
RQVSKEIKQKSTRIYMQIAELNDELNNLFKEWKRWQWHIDHAAAAAAAAA
AAALTEFEANWTSILKAHYLADMEHWLVQRRKKKLMDE
3D structure
PDB7b9v Structural basis for conformational equilibrium of the catalytic spliceosome.
ChainG
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G S10 V11 R14 S9 V10 R13
BS02 rna G N4 A8 S30 R31 R64 N3 A7 S29 R30 R63
BS03 rna G S2 R3 K56 Q60 S1 R2 K55 Q59
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 17:29:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7b9v', asym_id = 'G', title = 'Structural basis for conformational equilibrium of the catalytic spliceosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7b9v', asym_id='G', title='Structural basis for conformational equilibrium of the catalytic spliceosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000350', uniprot = '', pdbid = '7b9v', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000350', uniprot='', pdbid='7b9v', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>