Structure of PDB 7ad8 Chain G

Receptor sequence

>7ad8G (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]

ICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDC
DLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEA
KEVRQENREKMKQKKFDKKVKELRRAVRSSVWKR

3D structure

PDB

7ad8 The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	G	L138 T140 T142 H171 M178	L35 T37 T39 H68 M75
BS02	dna	G	Q174 W175 R211	Q71 W72 R108
BS03	ZN	G	E107 C108	E4 C5

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0005515	protein binding
GO:0019904	protein domain specific binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:1990837	sequence-specific double-stranded DNA binding

	Biological Process
GO:0000715	nucleotide-excision repair, DNA damage recognition
GO:0006281	DNA repair
GO:0006284	base-excision repair
GO:0006289	nucleotide-excision repair
GO:0009650	UV protection
GO:0010996	response to auditory stimulus
GO:0034504	protein localization to nucleus
GO:0070914	UV-damage excision repair
GO:1901255	nucleotide-excision repair involved in interstrand cross-link repair

	Cellular Component
GO:0000110	nucleotide-excision repair factor 1 complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005662	DNA replication factor A complex
GO:0045171	intercellular bridge

External links

PDB	RCSB:7ad8, PDBe:7ad8, PDBj:7ad8
PDBsum	7ad8
PubMed	33166411
UniProt	P23025\|XPA_HUMAN DNA repair protein complementing XP-A cells (Gene Name=XPA)