Structure of PDB 7a4p Chain G

Receptor sequence
>7a4pG (length=99) Species: 2649997 (Chlorella ohadii) [Search protein sequence]
LADVNLVVGGCTVGALALGRFVFLPFHRASLAKAGMPKQNGMTHLQAGDA
RAEEASFILKTNDPAGFTVVDVMAWGALGHAAAFYILATSSLGLDRNPF
3D structure
PDB7a4p Cryo-EM photosystem I structure reveals adaptation mechanisms to extreme high light in Chlorella ohadii.
ChainG
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G V1297 M1300 V70 M73
BS02 CLA G F1253 H1254 S1257 L1258 F26 H27 S30 L31
BS03 CLA G N1232 V1235 G1236 H1307 N5 V8 G9 H80
BS04 CLA G R1247 F1248 T1288 N1289 D1290 P1291 F1294 R20 F21 T61 N62 D63 P64 F67
BS05 CLA G T1316 R1323 N1324 P1325 F1326 T89 R96 N97 P98 F99
BS06 ERG G Y1312 T1316 S1317 R1323 Y85 T89 S90 R96
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a4p, PDBe:7a4p, PDBj:7a4p
PDBsum7a4p
PubMed34462576
UniProtA0A2P6TZI8

[Back to BioLiP]